SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003491 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003491
Domain Number 1 Region: 2-211
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.32e-42
Family FCH domain 0.000000135
Further Details:      
 
Domain Number 2 Region: 307-376
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-16
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003491   Gene: ENSGGOG00000003548   Transcript: ENSGGOT00000003571
Sequence length 386
Comment pep:novel chromosome:gorGor3.1:9:113471300:113577510:-1 gene:ENSGGOG00000003548 transcript:ENSGGOT00000003571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYKYT
SCKAFISTLNEMNDYAGQHEVISENMASQIIVDLARYVQELKQERKSNFHDGRKAQQHIE
TCWKQLESAKRKKERNCKEEKSIQNFIEKSNASINISTVDICKGATPEDFSNLPPEQRRK
KLQQKVDELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRLET
QKFEAWLAEVEGRLPARNEQARRQSGLYDSQNPPTVNNCAQDRESSPDGSYTEEQNQESE
VKVLATDFDDEFDDEEPLPAIGTCKALYTFEGQNEGTISVVEGETLYVIEEDKGDGWTRI
RRNEDEEGYVPTSYVEVCLDKNAKDS
Download sequence
Identical sequences ENSGGOP00000003491 ENSGGOP00000003491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]