SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003513 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003513
Domain Number 1 Region: 627-712,840-950,1134-1302
Classification Level Classification E-value
Superfamily L domain-like 8.16e-45
Family Internalin LRR domain 0.016
Further Details:      
 
Domain Number 2 Region: 37-185
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 3.66e-27
Family Outer arm dynein light chain 1 0.001
Further Details:      
 
Domain Number 3 Region: 1027-1105
Classification Level Classification E-value
Superfamily L domain-like 0.0000000969
Family Internalin LRR domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003513   Gene: ENSGGOG00000003571   Transcript: ENSGGOT00000003593
Sequence length 1364
Comment pep:novel chromosome:gorGor3.1:14:40847442:40980382:1 gene:ENSGGOG00000003571 transcript:ENSGGOT00000003593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIESENLNQEEIIKELCLCNGLSYEMVGQEGSDTSKLEMFFLGYPRIVGLSLFPNLTSLT
IVAQDIKEISGLEPCLQLKELWIAECCIEKIEGLQECRNLEKLYLYFNKISKIENLEKLI
KLKVLWLNHNTIKNIEGLQTLKNLKDLNLAGNLINSIGRCLDSNEQLERLNLSGNQICSF
KTTAMKKIMYYNMRIKTLQRHLKEDLEKLNDRKCKLQKLPEERVKLFSFVKKTLERELAE
LKGSGKGHSDGSNNSKVTDPETLKSCETVTEEPSLQQKILTKLNALNERVTFWNKKLDEI
EAIYHIEVKQKKKSHGLLIPLLLIELETVGNFHFEEGTRSDDWFNFCYELILSRFCAWDF
RTYGITGVKVKRIIKVNNRILRLKFQEKFQKFLENEDMHDSESYRRMLECLFYVFDPEVS
VKKKHLLQILEKGFKDSETSKLPLKKEAIILSNSLSISECPRIEFLQQKHKDEKKNSLKH
ELFRHGILLITKVFLGQSVQAHEKESISQSNYPMVNSVFIPRKYLLNSVMGQRNCDCSVR
QCKWFVFDHDLVLPEYVVEFEYITMVKAPSLFSVFNNVILEESKKTPEVSVFSKDLKFDD
EVIKMEPRIKARPKLISLDDKTILSLAKTSVYSHIVSLNLHGNSLSKLRDLSKLTGLRKL
NISFNEFTCLDDVYHLYNLEYLDASHNHVITLEGFRGLMKLKHLDLSWNQLKKSGDEINM
LCKHTTSLLTLDIQHNPWQKPATLRLSVIGRLKTLTHLNGVFISEEEATAAMKFIAGTRI
TQLSLLRHSSTKEERPRILSIWPSAKILTQISKLGPHLHPSGNCYLKITALNLDGQHLFE
ITNLEKLENLKWASFSNNNLTKMEGLESCINLEELTLDGNCISKIEGISKMTKLTRLSIN
NNLLTGWEEHTFDNMLHLHSLSLENNRITSLSGLQKSFTLVELYISNNYIAVNQEMYNLK
GLCNLVILDMCGNIIIWNQENYRLFVIFHLPELKALDGIPIEPPETDSAKDLFGGRLTSD
MIAERQGHSNFKQMQELNWTSSSIRTVDLIPVDQFRNVCNVNLQNNHLTSFSGLIYLPNV
KVLCLNYNHIESIMPRLKPQTHLTSRQLLYQKVPSSGYGQQGISKTNRDIMSSENLPPIM
HSLEVLHLGYNGICNLMKLQLNRLRNLKFLFLQGNEISQVEGLDNLVVLQELVVDHNRIR
SFNDSAFAKPSSLLALHLEENRLRELGKLQSFVKLEKLFLGYNKIQDITELEKLDVISTL
RELTVYGNPICRKMLHRHMLIFRLPNLQMLDGSPVNSDDRAKAEFHLAELQAKKNSLIPV
THSPMDGRSFGQVKTPPIKITNVILPGGFRHYLGSDVTLTPEVE
Download sequence
Identical sequences ENSGGOP00000003513 ENSGGOP00000003513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]