SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003555 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003555
Domain Number 1 Region: 352-613
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.96e-77
Family Protein kinases, catalytic subunit 0.000000000248
Further Details:      
 
Domain Number 2 Region: 6-146
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-45
Family Pleckstrin-homology domain (PH domain) 0.0000488
Further Details:      
 
Domain Number 3 Region: 234-382
Classification Level Classification E-value
Superfamily SH2 domain 8.75e-32
Family SH2 domain 0.00000188
Further Details:      
 
Domain Number 4 Region: 175-256
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-17
Family SH3-domain 0.0000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003555   Gene: ENSGGOG00000003614   Transcript: ENSGGOT00000003635
Sequence length 620
Comment pep:novel chromosome:gorGor3.1:5:141236321:141310991:1 gene:ENSGGOG00000003614 transcript:ENSGGOT00000003635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKY
HPNFWMDGKWRCCSQLEKLAAGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALY
DYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETHEWY
NKSISRDKAEKLLLDTGKEGAFMVRDSRTAGTYTVSVFTKAVVSENNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAGLRYGKWVIDP
SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ
LYGVCLEKAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPE
DRPAFSRLLRQLAEIAESGL
Download sequence
Identical sequences ENSGGOP00000003555 ENSGGOP00000003555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]