SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003600 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003600
Domain Number 1 Region: 6-238
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.33e-59
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 249-442
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003600   Gene: ENSGGOG00000003654   Transcript: ENSGGOT00000003681
Sequence length 881
Comment pep:novel chromosome:gorGor3.1:16:25623184:25718967:-1 gene:ENSGGOG00000003654 transcript:ENSGGOT00000003681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSICHHSHKRLVACFQGQHGT
DAERRHKKLPLTALAQNMQEASTQLEDSLLGKMLETCGDAENQLALELSQHEVFVEKEIV
DPLYGIAEVEIPNIQKQRKQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEM
DEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKTLPEMRAH
QDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKKLK
AALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDL
WRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWARNEGTLAEMA
AATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAFVPLTTPNSNHSFHTGNDSDSGTLERK
RPASMAVMEGDLVKKESFGVKLMDFQAHRRGGTLNRKHISPAFQPPLPPTDGSTMVPAGP
EPPPQSSRAESSSGGGTVPSSAGILDQGPSPGDGSPPKPKDPVSAAVPAPGRNNSQIASG
QNQPQAAAGSHQLSVGQPHNAAGPSPHTLRRAVKKPAPAPPKPGNPPPGHPGGQSSSGTS
QHPPSLSPKPPTRSPSPPTQHTGQPPGQPSAPSQLSAPRRYSSSLSPIQAPNHPPPQPPT
QATPLMHTKPNSQGPPNPMALPSEHGLEQPSHTPPQTPTPPSTPPLGKQNPSLPAPQTLA
GGNPETAQPHAGTLPRPRPVPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDS
NSRVSEPHRSIFPEMHSDSASKDVPGRILLDIDNDTESTAL
Download sequence
Identical sequences G3QM70
XP_004057420.1.27298 ENSGGOP00000003600 ENSGGOP00000003600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]