SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003691 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003691
Domain Number 1 Region: 8-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000602
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003691   Gene: ENSGGOG00000003757   Transcript: ENSGGOT00000003778
Sequence length 151
Comment pep:novel chromosome:gorGor3.1:11:122827434:122848678:1 gene:ENSGGOG00000003757 transcript:ENSGGOT00000003778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEW
GSKVEDRFYNSHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVK
IQAAFRGHIAREEAKKMKTNSFQNEEREENK
Download sequence
Identical sequences G3QMF2
ENSGGOP00000003691 XP_004052393.1.27298 ENSGGOP00000003691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]