SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003726 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003726
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-18
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 
Domain Number 2 Region: 54-78
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000366
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003726   Gene: ENSGGOG00000003792   Transcript: ENSGGOT00000003813
Sequence length 170
Comment pep:novel chromosome:gorGor3.1:22:13815150:13858013:-1 gene:ENSGGOG00000003792 transcript:ENSGGOT00000003813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKF
LLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKR
LSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG
Download sequence
Identical sequences A0A024R1I1 A0A096NJE8 A0A0D9RB72 A0A2K5NIP3 A0A2K6AEL7 A0A2K6C5Y3 A0A2K6JYC2 A0A2K6NNP5 F7H3N6 G3QMI5 G7PHI4 H2P402 H2QLG4 Q9UDW3
gi|51173755|ref|NP_001003692.1| gi|9506863|ref|NP_061976.1| ENSPPYP00000013048 ENSGGOP00000003726 ENSGGOP00000003726 ENSP00000344241 ENSP00000380883 9544.ENSMMUP00000024145 9600.ENSPPYP00000013048 9606.ENSP00000344241 NP_001003692.1.87134 NP_001003692.1.92137 NP_001181274.1.72884 NP_001305058.1.87134 NP_001305058.1.92137 NP_061976.1.87134 NP_061976.1.92137 XP_001136635.3.37143 XP_002831041.1.23681 XP_003812048.1.60992 XP_003812049.1.60992 XP_004063295.1.27298 XP_004063296.1.27298 XP_005567708.1.63531 XP_007973540.1.81039 XP_010357747.1.97406 XP_010357752.1.97406 XP_011748965.1.29376 XP_011748966.1.29376 XP_011748968.1.29376 XP_011851086.1.47321 XP_011851087.1.47321 XP_011851088.1.47321 XP_011851089.1.47321 XP_011851090.1.47321 XP_011893165.1.92194 XP_011893166.1.92194 XP_011893167.1.92194 XP_015005488.1.72884 XP_015005489.1.72884 XP_016794422.1.37143 XP_017711108.1.44346 XP_018874310.1.27298 XP_515063.3.37143 ENSMMUP00000024145 ENSP00000344241 ENSPPYP00000013048 ENSMMUP00000024145 ENSP00000344241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]