SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003730 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003730
Domain Number 1 Region: 381-517
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.57e-32
Family Gelsolin-like 0.00018
Further Details:      
 
Domain Number 2 Region: 7-140
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.97e-31
Family Gelsolin-like 0.0000685
Further Details:      
 
Domain Number 3 Region: 605-716
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.24e-27
Family Gelsolin-like 0.0001
Further Details:      
 
Domain Number 4 Region: 498-600
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.92e-25
Family Gelsolin-like 0.00048
Further Details:      
 
Domain Number 5 Region: 238-427
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.02e-21
Family C-terminal, gelsolin-like domain of Sec23/24 0.01
Further Details:      
 
Domain Number 6 Region: 116-224
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 7.59e-21
Family C-terminal, gelsolin-like domain of Sec23/24 0.015
Further Details:      
 
Domain Number 7 Region: 781-855
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 7.85e-21
Family VHP, Villin headpiece domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003730   Gene: ENSGGOG00000003789   Transcript: ENSGGOT00000003818
Sequence length 855
Comment pep:novel chromosome:gorGor3.1:3:39022921:39036402:1 gene:ENSGGOG00000003789 transcript:ENSGGOT00000003818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISKGLPGMQGGLHIWISENRKMVPVPEGAYGNFFEEHCYVILHSPKATQGASSDLHYWVG
KQAGAEAQGAAEAFQQRLQDELGGQTVLHREAQAHESDCFCSYFRLGIIYRKGGLASDLK
HVETNLFNIQRLLHIKGRKHVSATEVELSWNSFNKGDIFLLDLGKMMIQWNGPKTSISEK
ARGLALTYSLRDRERGGRAQIGVVDDEAKAPDLMQIMEAVLGRRVGSLRAATPSKDINQL
QKANVRLYHVYEKGKDLVVLELATPPLTQDLLQEEDFYILDQGGFKIYVWQGRMSSLQER
KAAFSRAVGFIQAKGYPTYTNVEVVRGGTWNLGGMVEEWAGRRWCGGGQRAPLKPTVPPS
DKSIHVKLDVGKLHTQPKLAAQLRMVDDGSGKVEVWCIQDLHRQPVDPKRHGQLCAGNCY
LVLYTYQRLGRVQYILYLWQGHQATADEIEALNSNAEELDVIYGGVLVQEHVTMGSEPPH
FLAIFQGQLVIFQERAGHHGKGQPASTTRLFQVQGTDSHNTRTMEVPARASSLNSSDIFL
LVTASVCYLWFGKGCNGDQREMARVVVTVISRKNEETVLEGQEPPHFWEALGGRAPYPSN
KRLPEEVPSFQPRLFECSSHVGCLVLAEVVFFSQEDLDNYDIMLLDTWQEIFLWLGEAAS
EWKEAVAWGQEYLKTHPAGRSPATPIVLVKQGHEPPTFIGWFFTWDPYKQSHPSHKEVVD
GSPAAASTISEITAEVNNFRLSRWPGNGRAGAVALQALKGSQDSSENDLVRSPKSGGSRT
SSSVSSTSATINGGLRREQLMHQAVEDLPEGVDPARREFYLSDSDFQDIFGKSKEEFYSM
ATWRQRQEKKQLGFF
Download sequence
Identical sequences ENSGGOP00000003730 ENSGGOP00000003730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]