SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003743 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003743
Domain Number 1 Region: 178-373
Classification Level Classification E-value
Superfamily E set domains 5.13e-76
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000463
Further Details:      
 
Domain Number 2 Region: 69-194
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.28e-23
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003743   Gene: ENSGGOG00000003812   Transcript: ENSGGOT00000003831
Sequence length 423
Comment pep:novel chromosome:gorGor3.1:21:26083022:26375200:-1 gene:ENSGGOG00000003812 transcript:ENSGGOT00000003831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKD
GKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGD
MDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSI
VNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAK
LIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKE
ELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYET
STPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENE
SKV
Download sequence
Identical sequences A0A096NJ31 A0A2I2YHE6 A0A2I3HQ04 A0A2J8M7S6 A0A2J8UAG6 A0A2K5JXM9 A0A2K5MR77 A0A2K5Q4N5 A0A2K5XDZ3 A0A2K6CT00 A0A2K6GL40 A0A2K6TT18 F7BNG3 F7DHW8 G7P104 P48051
gi|4504843|ref|NP_002231.1| NP_002231.1.87134 NP_002231.1.92137 XP_001083031.1.72884 XP_003263970.1.23891 XP_003823988.1.60992 XP_003927666.1.74449 XP_004062829.1.27298 XP_005548751.1.63531 XP_006146348.1.99106 XP_007966129.1.81039 XP_008567419.1.73410 XP_011724372.1.29376 XP_011809399.1.43180 XP_011809401.1.43180 XP_011839528.1.47321 XP_011839529.1.47321 XP_011892627.1.92194 XP_011892628.1.92194 XP_012495543.1.63892 XP_012495544.1.63892 XP_017381736.1.71028 XP_020140366.1.48125 XP_020140367.1.48125 ENSPTRP00000057478 ENSP00000477437 ENSGGOP00000003743 ENSCJAP00000004712 ENSP00000288309 ENSP00000477437 ENSMMUP00000035638 9544.ENSMMUP00000035638 9606.ENSP00000383330 ENSP00000288309 ENSNLEP00000005750 ENSCJAP00000004712 ENSCJAP00000004717 ENSMMUP00000023837 ENSGGOP00000003743 ENSPTRP00000057478 ENSNLEP00000005750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]