SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003917 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003917
Domain Number 1 Region: 21-267
Classification Level Classification E-value
Superfamily Aquaporin-like 2.49e-76
Family Aquaporin-like 0.00000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003917   Gene: ENSGGOG00000003993   Transcript: ENSGGOT00000004014
Sequence length 292
Comment pep:novel chromosome:gorGor3.1:9:34112912:34119349:-1 gene:ENSGGOG00000003993 transcript:ENSGGOT00000004014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTIN
LAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVF
GLYYDAIWRFADNQLFVSGPNGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVD
PYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQ
HWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSTEEENVKLAHVKHKEQI
Download sequence
Identical sequences G3QN14
ENSGGOP00000003917 ENSGGOP00000003917 XP_004047976.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]