SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003943 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003943
Domain Number 1 Region: 1010-1211
Classification Level Classification E-value
Superfamily vWA-like 2.23e-58
Family Integrin A (or I) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 143-337
Classification Level Classification E-value
Superfamily vWA-like 2.67e-57
Family Integrin A (or I) domain 0.0000943
Further Details:      
 
Domain Number 3 Region: 1230-1433
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-35
Family Laminin G-like module 0.038
Further Details:      
 
Domain Number 4 Region: 536-702
Classification Level Classification E-value
Superfamily Fibronectin type III 2.66e-22
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 739-909
Classification Level Classification E-value
Superfamily Fibronectin type III 1.7e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 6 Region: 354-440
Classification Level Classification E-value
Superfamily Fibronectin type III 1.88e-17
Family Fibronectin type III 0.00084
Further Details:      
 
Domain Number 7 Region: 31-115
Classification Level Classification E-value
Superfamily Fibronectin type III 1.57e-16
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 446-532
Classification Level Classification E-value
Superfamily Fibronectin type III 4.13e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 9 Region: 922-1005
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000406
Family Fibronectin type III 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003943   Gene: ENSGGOG00000004015   Transcript: ENSGGOT00000004040
Sequence length 1796
Comment pep:novel chromosome:gorGor3.1:8:119689432:120012062:1 gene:ENSGGOG00000004015 transcript:ENSGGOT00000004040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFQRKMRYWLLPPFLAIVYFCTIVQGQVAPPTRLRYNVISHDSIQISWKAPRGKFGGY
KLLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDL
EKRKDPKPRVKVVDRGNGSRPSSPEEVKFVCQTPAIADIVILVDGSWSIGRFNFRLVRLF
LENLVTAFDVGSEKTRIGLAQYSGDPRIEWHLNAFSTKDEVIEAVRNLPYKGGNTLTGLA
LNYIFENSFKPEAGSRTGVSKIGILITDGKSQDDIIPPSRNLRESGVELFAIGVKNADVN
ELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTLCSRVEEQDREIKASAHAITGPPTELI
TSEVTARSFMVNWTHAPGNVEKYRVVYYPTRGGKPDEVVVDGTVSSTVLKNLMSLTEYQI
AVFAIYAHTASEGLRGTETTLALPMASDLLLYEVTENSMRVKWDAVPGASGYLILYAPLT
EGLAGDEKEMKIGETHTDIELSGLLPNTEYTVTVYAMFGEEASDPVTGQETTLALSPPRN
LRISNVGSNSARLTWDPTSRQINGYRIVYNNADGTEINEVEVDPITTFPLKGLTPLTEYT
IAIFSIYDEGQSEPLTGVFTTEEVPAQQYLEIDEVTTDSFRVTWHPLSADEGLHKLMWIP
VYGGKTEEVVLKEEQDSHVIEGLEPGTEYEVSLLAVLDDGSESEVVTAVGTTLDSFWTEP
ATTIVPTTSVTSVFQTGIRNLVVGDETTSSLRVKWDISDSDVQQFRVTYMTAQGDPEEEV
IGTVMVPGSQNNLLLKPLLPDTEYKVTVTPIYTDGEGVSVSAPGKTLPSSGPQNLRVSEE
WYNRLRITWDPPSSPVKGYRIVYKPVSVPGPTLETFVGADINTILITNLLSGMDYNVKIF
ASQASGFSDALTGMVKTLFLGVTNLQAKHVEMTSLCAHWQVHRHATAYRVVIESLQDRQK
QESTVGGGTTRHCFYGLQPDSEYKISVYTKLQEIEGPSVSIMEKTQSLPTRPPTFPPTIP
PAKEVCKAAKADLVFMVDGSWSIGDENFNKIISFLYSTVGALNKIGTDGTQVAMVQFTDD
PRTEFKLNAYKTKETLLDAIKHISYKGGNTKTGKAIKYVRDTLFTAESGTRRGIPKVIVV
ITDGRSQDDVNKISREMQLDGYSIFAIGVADADYSELVSIGSKPSARHVFFVDDFDAFKK
IEDELITFVCETASATCPMVHKDGIDLAGFKMMEMFGLVEKDFSSVEGVSMEPGTFNVFP
CYQLHKDALVSQPTRYLHPEGLPSDYTISFLFRILPDTPQEPFALWEILNKNSDPLVGVI
LDNGGKTLTYFNYDQSGDFQTVTFEGPEIRKIFYGSFHKLHIVVSETLVKVVIDCKQVGE
KAMNASANITSDGVEVLGKMVRSRGPGGNSAPFQLQMFDIVCSTSWANTDKCCELPGLRD
DESCPDLPHSCSCSETNEVALGPAGPPGGPGLRGPKGQQGEPGPKGPDGPRGEIGLPGPQ
GPPGPQGPSGLSIQGMPGMPGEKGEKGDTGLPGPQGIPGGVGSPGRDGSPGQRGLPGKDG
SSGPPGPPGPIGIPGTPGVPGITGSMGPQGALGPPGVPGAKGERGERGDLQSQAMVRSVA
RQVCEQLIQSHMARYTAILNQIPSHSSSVRTIQGPPGEPGRPGSPGAPGEQGPPGTPGFP
GNAGVPGTPGERGLTGIKGEKGNPGVGTQGPRGPPGPAGPSGESRPGSPGPPGSPGPRGP
PGHLGVPGPQGPSGQPGYCDPSSCSAYGVRAPHPDQPEFTPVQDELEAMELWGPGV
Download sequence
Identical sequences A0A2I2YFM7
ENSGGOP00000003943 ENSGGOP00000003943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]