SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003999 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003999
Domain Number 1 Region: 173-419
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.61e-62
Family G proteins 0.0000000883
Further Details:      
 
Domain Number 2 Region: 497-600
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 8.22e-32
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 401-491
Classification Level Classification E-value
Superfamily Translation proteins 1.25e-21
Family Elongation factors 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003999   Gene: ENSGGOG00000004071   Transcript: ENSGGOT00000004096
Sequence length 604
Comment pep:novel chromosome:gorGor3.1:16:12282569:12335463:-1 gene:ENSGGOG00000004071 transcript:ENSGGOT00000004096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPGPGPCGGGGSLAAAAEAQRENLSAAFSRQLNVNAKPFVPNVHAAEFVPSFLRGPAA
PPPPAGGAANNHGAGSGAGGPAAPVESSQEEQSLCEGSNSAVSMELSEPIVENGETEMSP
EESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAPKKEHVNV
VFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYRYLSWALDTNQEERD
KGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFE
KGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKD
IHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGT
VVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEIL
PGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKK
SGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLV
PEKD
Download sequence
Identical sequences ENSGGOP00000003999 ENSGGOP00000003999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]