SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004018 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004018
Domain Number 1 Region: 33-90,128-252
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.52e-40
Family G proteins 0.00000289
Further Details:      
 
Domain Number 2 Region: 248-362
Classification Level Classification E-value
Superfamily Translation proteins 2.59e-37
Family Elongation factors 0.0000306
Further Details:      
 
Domain Number 3 Region: 364-437
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.02e-18
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004018   Gene: ENSGGOG00000004093   Transcript: ENSGGOT00000004115
Sequence length 466
Comment pep:novel chromosome:gorGor3.1:12:10533991:10555269:1 gene:ENSGGOG00000004093 transcript:ENSGGOT00000004115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGEGRVTLGQPHLSRQDLTTLDVTKLTPLSQEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTIRFKNELERNITIKLGYANAKIYKLDDPSCPQPECYRSCGSSTPDEFPTDIPGT
KGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQETEVRPGI
VSKDTEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQILGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEIHLIHLDLIKELEWGPVLTNETQRKSAANF
Download sequence
Identical sequences ENSGGOP00000004018 ENSGGOP00000004018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]