SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004105 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004105
Domain Number 1 Region: 115-397
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000224
Further Details:      
 
Domain Number 2 Region: 400-692
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.84e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004105   Gene: ENSGGOG00000004177   Transcript: ENSGGOT00000004206
Sequence length 702
Comment pep:novel chromosome:gorGor3.1:10:141778397:141963963:1 gene:ENSGGOG00000004177 transcript:ENSGGOT00000004206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STMEPLCPLLLVGFSLPLTRALRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLL
LLVLLLAAYFFRFRKQRKAVVSASDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVE
HLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVIL
SQVDGIPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFWRMVWEQKSATIVMLTNLKE
RKEEKCHQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIQPQLPDGCKAPRLVSQLHF
TSWPDFGVPFTPIGMLKFLKKVKMLNPVHAGPIVVHCSAGVGRTGTFIVIDAMMAMMHAE
QKVDVFEFVSRIRNQRPQMVQTDMQYTFIYQALLEYYLYGDTELDVSSLEKHLQTMHGTT
THFDKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEY
TDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEWKSHTIVMLTEVQEREQDKCYQ
YWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEI
GIPAEGKGMIDLIAAVQKQQQQTGNHPITVHCSAGAGRTGTFIALSNILERVKAEGLLDV
FQAVKSLRLQRPHMVQTLEQYEFCYKVVQDFIDIFSDYANFK
Download sequence
Identical sequences ENSGGOP00000004105 ENSGGOP00000004105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]