SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004167 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004167
Domain Number 1 Region: 146-734
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 9.18e-194
Family Myeloperoxidase-like 0.000000000091
Further Details:      
 
Domain Number 2 Region: 741-797
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000514
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 794-843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000212
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004167   Gene: ENSGGOG00000004239   Transcript: ENSGGOT00000004270
Sequence length 933
Comment pep:novel chromosome:gorGor3.1:2a:1413633:1538826:1 gene:ENSGGOG00000004239 transcript:ENSGGOT00000004270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQR
NLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALS
EDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNRDHPRWGASNTALARWLPPV
YEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD
IAFTPQSTSKAAFGGGADCQMTCENQNPCFPIQXXXXXXXXAPPACLPFYRSSAACGTGD
QGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSG
RAYLPFAPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAA
LKALNAHWSADAVYQEARKVVGALHQIITLRDYVPRILGPEAFQQYVGPYEGYDSTANPT
VSNVFSTAAFRFGHATIHPLVRRLDASFQEHPDLPGLWLHQAFFSPWTLLRGGGLDPLIR
GLLARPAKLQVQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGL
PRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLIGKQ
MKALRDGDWFWWENRRIFTDAQRRELEKHSLSRVICDNTGLTRVPVDAFQVGKFPEDFES
CDSIPGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQL
TCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVD
SGRLPRATWVSILLAALLIGGFAGLTSTVICRWTRTGTKSTLPISETGGGTPELRCGKHQ
AVGTSPQRAAAQDSEQESAGMEGRDTHRLPRAL
Download sequence
Identical sequences ENSGGOP00000004167 ENSGGOP00000004167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]