SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004170 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004170
Domain Number 1 Region: 116-294
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000194
Further Details:      
 
Domain Number 2 Region: 622-728
Classification Level Classification E-value
Superfamily SH2 domain 7.27e-31
Family SH2 domain 0.000000653
Further Details:      
 
Domain Number 3 Region: 322-429
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-30
Family SH2 domain 0.000000627
Further Details:      
 
Domain Number 4 Region: 4-83
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-17
Family SH3-domain 0.00000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004170   Gene: ENSGGOG00000004248   Transcript: ENSGGOT00000004273
Sequence length 731
Comment pep:novel chromosome:gorGor3.1:17:28539856:28616114:-1 gene:ENSGGOG00000004248 transcript:ENSGGOT00000004273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSKTEADVEQQALTLPDLAEQ
FAPPDIAPPLLIKLLEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVHV
LADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQ
YLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNER
QPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDAS
TKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLD
VKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKR
TAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDS
RRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNE
NTEENFLSCLPSQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSK
QGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVT
LAYPVYAQQRR
Download sequence
Identical sequences ENSGGOP00000004170 ENSGGOP00000004170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]