SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004191 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004191
Domain Number 1 Region: 357-435
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-22
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 123-158
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000146
Family Intermediate filament protein, coiled coil region 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004191
Domain Number - Region: 194-270
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0157
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004191   Gene: ENSGGOG00000004274   Transcript: ENSGGOT00000004294
Sequence length 494
Comment pep:novel chromosome:gorGor3.1:5:43260803:43266819:1 gene:ENSGGOG00000004274 transcript:ENSGGOT00000004294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSNNTMSLSVRTPGLSRRLSSQSVIGRPRGMSASSVGSGYGGSALGFGVSCGGGFSAA
SMFGSSSGFGGGSGSSMAGGLGAGYGRALGGGSFGGLGMGFGGSPGGGSLGILSGNDGGL
LSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYY
PLIEDLRNKIISASIGNAQLLLQIDNARLAAEDFRMKYENELALRQGVEADINGLRRVLD
ELTLTRTDLEMQIESLNEELAYMKKNHEDELQSFRVGGPGEVSVEMDAAPGVDLTRLLND
MRAQYETIAEQNRKDAEVWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQ
SQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKA
RLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNG
EVVSSQVQEIEELM
Download sequence
Identical sequences G3QNR7
ENSGGOP00000004191 XP_004041833.1.27298 ENSGGOP00000004191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]