SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004197 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004197
Domain Number 1 Region: 299-377
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.44e-24
Family Intermediate filament protein, coiled coil region 0.00077
Further Details:      
 
Domain Number 2 Region: 68-104
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000115
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004197
Domain Number - Region: 255-304
Classification Level Classification E-value
Superfamily Eea1 homodimerisation domain 0.0484
Family Eea1 homodimerisation domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004197   Gene: ENSGGOG00000004278   Transcript: ENSGGOT00000004300
Sequence length 431
Comment pep:novel chromosome:gorGor3.1:5:43243817:43251629:1 gene:ENSGGOG00000004278 transcript:ENSGGOT00000004300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSPRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLT
GGGDLFVGNEKMAMQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYEINAPRAGRDYSAY
YRQIEELRNQVRDDACVSNSVFSFKINQEVIYVSSFMHQYETERGIRLTVEADLQGLNKV
FDDLTLHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHLGNTVNVEVDAAPGLNLGAIM
NEMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIE
LQSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSDMERQNNEYHILLDI
KTRLEQEIATYRRLLEGEDVNKKKKNRTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKIV
SSEVKEVEENI
Download sequence
Identical sequences ENSGGOP00000004197 ENSGGOP00000027602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]