SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004216 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004216
Domain Number 1 Region: 61-344
Classification Level Classification E-value
Superfamily L domain-like 2.78e-41
Family Ngr ectodomain-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004216   Gene: ENSGGOG00000004297   Transcript: ENSGGOT00000004319
Sequence length 420
Comment pep:novel chromosome:gorGor3.1:6:82318323:82320181:1 gene:ENSGGOG00000004297 transcript:ENSGGOT00000004319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLVSAVSVQPPLPD
QCPALCECSEAARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAEL
AALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELIL
NHIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYLPRDVLAQLPSLRHLD
LSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDC
HMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTSYVFLG
IVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV
Download sequence
Identical sequences G3QNU0
XP_004044382.1.27298 ENSGGOP00000026324 ENSGGOP00000004216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]