SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004231 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004231
Domain Number 1 Region: 303-379
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.24e-20
Family Intermediate filament protein, coiled coil region 0.0012
Further Details:      
 
Domain Number 2 Region: 73-106
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000424
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004231
Domain Number - Region: 184-298
Classification Level Classification E-value
Superfamily Prefoldin 0.0759
Family Prefoldin 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004231   Gene: ENSGGOG00000004314   Transcript: ENSGGOT00000004334
Sequence length 395
Comment pep:novel chromosome:gorGor3.1:5:59165096:59167815:1 gene:ENSGGOG00000004314 transcript:ENSGGOT00000004334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLRGSLCVSFSRFSFGGACGLGGGYGGGFSSSSSFASGFGGGYGGGLGAGFGGGLGAGLG
GGFAGGDGLLVGSEKVTMQHLNDRLASYLDKVRALEEANADLEVKIRDWYLRQRPSEIKD
YSPYFKTIEDLRHKIIAATIENAQPILQIDNARLAADDFRTNMEHELALRQTVEAGINGL
CRVLDELTLARTDLEMQMEGLKEELAYLRKNHEEEMLALRGQTGGEVNVETDAAPGMDLS
CILNEMRNQYEQMAKQNHRDAEAWFLSKTKELNKKVASSSELVQSSRSEVMELQRVFQGL
EMELQSQLSIKASLENSLEETKGCYCMQLSQIQGLIGSVEEQLAQLSCEMEQQSQEYQIL
LDMKTRLEQIATYCRLLEGEDAQPLLTSSSLSHSL
Download sequence
Identical sequences ENSGGOP00000004231 ENSGGOP00000004231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]