SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004288 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004288
Domain Number 1 Region: 30-200
Classification Level Classification E-value
Superfamily L domain-like 8.42e-32
Family Leucine rich effector protein YopM 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004288   Gene: ENSGGOG00000004375   Transcript: ENSGGOT00000004393
Sequence length 261
Comment pep:novel chromosome:gorGor3.1:10:60687859:60691781:-1 gene:ENSGGOG00000004375 transcript:ENSGGOT00000004393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKGEKGPKGKKINLKVAKNCIKITFDGKKRLDLSKMGITTFPKCILHLSDVDELDLSRN
LIRKIPDSISKFQNLRWLDLHSNYIDKLPQSIGQMTSLLYLNVSNNRLTSNGLPVELKQL
KNIRTVNLGLNHLDSVPTTLGALKELHEVGLHDNLLNNIPVSMSKLPKLKKLNIKRNPFP
KPSESEMFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNL
ISPNSMAKDSWEDWRIRVTSS
Download sequence
Identical sequences ENSGGOP00000004288 ENSGGOP00000004288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]