SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004315 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004315
Domain Number 1 Region: 246-389
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004315   Gene: ENSGGOG00000004403   Transcript: ENSGGOT00000004422
Sequence length 596
Comment pep:novel chromosome:gorGor3.1:20:36183570:36208752:1 gene:ENSGGOG00000004403 transcript:ENSGGOT00000004422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VESSSMDGFWMEVEQIQQRDELREEDSGGNEGQLPEEGEAESQWLQDTGLSGLLGGLGLD
GDHQELLSTLTQTQVAAVCRRLDIYARSVRRQHKTPVRDVRDVFGVFNSGKVPPPTSSSV
QNKMSSENGDSGMKGAQLSSGASKSPPEEQAGREEAFNMDSAYSEQAAVLLQRSRPSRGG
TSAWGKCSLPKFTVPKGRLGVTRIGDLSLQDMRKVPSLALIELTALCDILGLDLKRSKAG
KWKAAETRLFGVPLDSLLEADHKVLPSTQVPLVLQALLSCLEKRGLDMEGILRVPGSQAR
VKGLEQKLERDFYAGLFSWDEVHHNDASDLLKKFIRKLPTPLLTAEYLPAFAVVPNIPNL
KQRLQVLHLLILILPEPNRNALKQLCQVLGFSDDPHKPLLRLFLKTQDVPPGSAYEEAPG
IYSSFHHPFILIHPSINLFLLDFLFQKPASQVASFLVAQVRKLNDSSSRRPQLCDAGLKT
WLRRMHADRDKAGDGLEAVSAPDPRQQTPKVAKIQVVWPIKDPLKVPLTPSTKVAHVLRQ
FTEHLSPGSKGQEDTNILLYEVGGNINEHRLDPDAYLLDLYRANPHGEWVLKQNPT
Download sequence
Identical sequences ENSGGOP00000004315 ENSGGOP00000004315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]