SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004344 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004344
Domain Number 1 Region: 86-320
Classification Level Classification E-value
Superfamily L domain-like 1.05e-41
Family Internalin LRR domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004344   Gene: ENSGGOG00000004427   Transcript: ENSGGOT00000004451
Sequence length 371
Comment pep:novel chromosome:gorGor3.1:3:47749618:47804373:-1 gene:ENSGGOG00000004427 transcript:ENSGGOT00000004451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHKVVVFDISVIRALWETRVKKHKAWQKKEAERLEKSALEKIKEEWNFVAECRRKGIPQ
AVYCKNGFIDTSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQ
THLREWHISNTLIQIIPTYIELFQAMRILDLPKNQISHLPAEIGCLKNLKELNVSFNYLK
SIPPELGDCENLERLDCSGNLELMELPFELSNLKQVTFVDISANKFSSVPICVLRMSNLQ
WLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSMLNLKKLTLLVVSGDHLVELPT
ALCDSSTPLKFVSLMDNPIDNAQCEDGNEIVESERDRQHFDKEVMKAYIEDLKERESVPS
YTTKVSFSLQL
Download sequence
Identical sequences G3QP59
XP_018880192.1.27298 ENSGGOP00000004344 ENSGGOP00000004344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]