SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004411 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000004411
Domain Number - Region: 535-626
Classification Level Classification E-value
Superfamily Prefoldin 0.000445
Family Prefoldin 0.014
Further Details:      
 
Domain Number - Region: 300-413
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0102
Family Myosin rod fragments 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004411   Gene: ENSGGOG00000004497   Transcript: ENSGGOT00000004521
Sequence length 722
Comment pep:novel chromosome:gorGor3.1:6:152520869:152644627:1 gene:ENSGGOG00000004497 transcript:ENSGGOT00000004521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLDCTSHIALGAASPAPEETYDHLSEVPVTRERLNHYRNVAQNARSELAATLVKFECAQ
SELRDLRSKMLSREVSCQELKAEMESYKENNARKSSLLTSLRDRVQELEEESAALSTSKI
RTEITAHAAIRENQELKKKVVELNEKLQKCSKENEENKKQVSKNCRKHEEFLTQLRDCLD
PDERNDKASDEDLILKLRDLRKENEFVKGQIVILEETINVHEMEAKASRETIMRLASEVN
REQKKAASCTEEKEKLNQDLLSTVEAKEALEREVKIFQERLLAGQQVWDASKQEVRLLKK
SSSELEKSLKASQDAVTASQSQYSSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREE
SRDRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGV
LRDNLNFEKQKYLKFLDQLSQKMKLDQMAAELGFDMRLDVVLARTEQLVRLESNAVIENK
TIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEEEKQGRTALVVERDKAHLTIRNLQK
KVERLQKELNTCRDLHTELKAKLADTNELKASAWLHFIKTLEQTKAIEDLNKSRDQLEKM
KEKAEKKLMSVKSELDTTEHEAKENKERARNMIEVVTSEMKTLKKSLEEAEKREKQLADF
REVVSQMLGLNVTSLALPDYEIIKCLERLIHSRQHHFVTCACLKDVTTGQERHPQGHLQL
LH
Download sequence
Identical sequences ENSGGOP00000004411 ENSGGOP00000004411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]