SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004424 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004424
Domain Number 1 Region: 719-995
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-78
Family Protein kinases, catalytic subunit 0.000000000763
Further Details:      
 
Domain Number 2 Region: 340-528
Classification Level Classification E-value
Superfamily L domain-like 4.54e-42
Family L domain 0.000000248
Further Details:      
 
Domain Number 3 Region: 50-217
Classification Level Classification E-value
Superfamily L domain-like 6.24e-42
Family L domain 0.000000431
Further Details:      
 
Domain Number 4 Region: 514-645
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.14e-22
Family Growth factor receptor domain 0.000000107
Further Details:      
 
Domain Number 5 Region: 192-346
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.05e-16
Family Growth factor receptor domain 0.0000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004424   Gene: ENSGGOG00000004509   Transcript: ENSGGOT00000004534
Sequence length 1258
Comment pep:novel chromosome:gorGor3.1:5:44427474:44458286:-1 gene:ENSGGOG00000004509 transcript:ENSGGOT00000004534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSTMELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQ
GNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVL
DNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPELCYQDTILWKDIFHKNN
QLALTLIDTNRSRACHPCSPVCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCH
EQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVT
ACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVT
SANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPD
SLPDLSIFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFV
HTVPWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRG
QECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCV
ARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCTHSCVDLDDKGCPAEQRASPLTSIISA
VVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKE
TELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGV
GSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLE
DVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRR
RFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVK
CWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDL
VDAEEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAP
SEGAGSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQP
EYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYL
TPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
Download sequence
Identical sequences ENSGGOP00000004424 ENSGGOP00000004424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]