SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004429 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004429
Domain Number 1 Region: 179-277
Classification Level Classification E-value
Superfamily Immunoglobulin 1.74e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 59-146
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000518
Family Growth factor receptor domain 0.0024
Further Details:      
 
Domain Number 3 Region: 131-176
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000675
Family Ovomucoid domain III-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004429   Gene: ENSGGOG00000004516   Transcript: ENSGGOT00000004539
Sequence length 311
Comment pep:novel chromosome:gorGor3.1:10:114585801:114588149:1 gene:ENSGGOG00000004516 transcript:ENSGGOT00000004539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVLAGLPANHAAAALALPVLLLLLVVLTPPPTGARPSPGPDYLRRGWLRLLLAEGEGC
APCRPEECAAPRGCLAGWVRDACGCCWECANLEGQLCDLDPSAHFYGHCGEQLECRLDTG
DDLSRGEVPEPLCACRSQSPLCGSDGHTYSQICRLQEAARARPDANLTVAHPGPCESGPQ
IVSHPYDTWNVTGQDVIFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQRFE
VTGWLQIQAVRPSDEGTYRCLARNALGQVEAPASLTVLTPDQLNSTGIPQLRSLNLVPEE
EAESEENDDYY
Download sequence
Identical sequences ENSGGOP00000004429 ENSGGOP00000021782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]