SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004490 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004490
Domain Number 1 Region: 578-741
Classification Level Classification E-value
Superfamily Sec7 domain 3.01e-53
Family Sec7 domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 777-916
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-23
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004490   Gene: ENSGGOG00000004574   Transcript: ENSGGOT00000004605
Sequence length 1057
Comment pep:novel chromosome:gorGor3.1:2a:111016381:111045560:1 gene:ENSGGOG00000004574 transcript:ENSGGOT00000004605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGDYRLPDHPQPMEILNLYLGDSLEPHPGECPRETCSHEDPPEPFEEQTWATDPAEPIR
QNVPPWGSGVELTHLGSWVHRDGPEPCQEQTWATDPPESTRQDAPPWGSGVELTHLGSPS
AQREHRQNTASPGSPVNSHLPGSPKQNRSTSTQVVFWAGILQAQMCVLDLEEELEKTEGL
KAGLKCCLPMPPVDLPGDTGLHSSPPENEDSGEDSSEPEGEGQAWLREGTPDSSPQWGAE
EGSMFFSNPLFLASPCSENSASGERFSWGASDSHAGVRTGPESPETLEPPLPEDTVLWEL
ESEPDLGDGAAISGHRTPPFPVPIYKPHSICWASVAAAEGAPAAPPGHRESEGDRLGPAP
FPGPSTNNPRIWGFSHQDSPSELRLQPGASLSPEGWQRGGPFWPQVTLNSQDRDEREGGH
PQESLPCTLAPCPWRSPASSPEPSSPESESRGPGPRPSPASSQEGSPQLQHHSSGILPKW
TLDASQSSLLETDGEQPSSLKKEEAGEAPKPGEEVKSEGTARPAETGDVQPDTHLTSAEH
HCENLRTPMNSSRLPGSPMPQARSPEEGQRPPAGDKLANGVRNNKVAWNLASRLYRLEGF
RKSEVAAYLQKNNDFSRAVAEEYLSFFQFGGQSLDRALRSFLQALVLSGETQERERILYQ
FSRRFHHCNPGVFPSVDSVHTLTCAIMLLNTDLHGQNIGKSMSCQEFITNLNGLRDGGNF
PKELLKALYWSIRSEKLEWAVDEEDTARPEKAQPSLPAGKMSKPFLQLAQDPTVPTYKQG
ILARKMHQDADGKKRTAPWGKRGWKMFHTLLRGMVLYFLKQGEDHCLEGESLVDQMVDEP
VGVHHSLATPATHYTKKPHVFQLRTADWRLYLFQAPTAKEMSSWIARINLAAATHSAPPF
PAAVGSQRRFVRPILPVGPARSSLEEQHRSHENCLDAASDDLLDLQRNLPERRGRSRELE
EYRLRKEYLEYEKTRYETYMQLLVARLHCPSDALDLWEEQLGREAGGTREPKLSLKKSHS
SPSLHQDEAPTTAKVKRNISERRTYRKIIPKRNRNQL
Download sequence
Identical sequences ENSGGOP00000020059 ENSGGOP00000004490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]