SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004524 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004524
Domain Number 1 Region: 96-279
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.53e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.0000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004524   Gene: ENSGGOG00000004612   Transcript: ENSGGOT00000004640
Sequence length 731
Comment pep:novel chromosome:gorGor3.1:6:160211425:160223196:-1 gene:ENSGGOG00000004612 transcript:ENSGGOT00000004640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLRSSHNASKTLNANNMETLIECQSEGDIKEHPLLASCESEDSICQLIEVKKRKKVLSW
PFLMRRLSPASDFSGALETDLKASLFDQPLSIICGDSDTLPRPIQDILTILCLKGPSTEG
IFRRAANEKARKELKEELNSGDAVDLERLPVHLLAVVFKDFLRSIPQKLLSSDLFEEWMG
ALEMQDEEDRIEALKQVADKLPRPNLLLLKHLVYVLHLISKNSEVNRMDSSNLAICIGPN
MLTLENDQSLSFEAQKDLNNKVKTLVEFLIDNCFEIFGENIPVHSSITSDDSLEHTDSSD
VSTLQNDSAYDSNDPDVESNSSSGISSPSRQPQVPMATAAGLDSAGPQDAREVSPEPIVS
TVARLKSSLAQPDRRYSEPSMPSSQECLESRVTNQTLTKSEGDFPVPRVGSRLESEEAED
PFPEEVFPAVQGKTKRPVDLKIKNLAPGSVLPRALVLKAFSSSSLDASSDSSPVASPSSP
KRNFFSRHQSFTTKTEKGKPSREIKKHSMSFSFAPHKKLLTKNLSAGSGKSQDFTRDHVP
RGVRKESQLAGRIVQENECETHNQTARGFCLRPHALSVDDVFQGADWERPGSPPSYEEAM
QGPAARLVAYESQTLGSMTVGSMRARMLEADCLLPPLPPAHHVEDSRHRGSKEPLPGHGL
SPLPERWKQSRTVHASGDSLGHVSGPGRPELLPLRTVSESMQRNKRDCLVRRCSQPVFEA
DQFQYAKESYI
Download sequence
Identical sequences G3QPM6
XP_004044944.1.27298 ENSGGOP00000004524 ENSGGOP00000004524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]