SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004673 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004673
Domain Number 1 Region: 198-539,620-641
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.17e-77
Family Myotubularin-like phosphatases 0.0000122
Further Details:      
 
Domain Number 2 Region: 43-174
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000148
Family GRAM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004673   Gene: ENSGGOG00000004764   Transcript: ENSGGOT00000004793
Sequence length 709
Comment pep:novel chromosome:gorGor3.1:1:128769800:128778093:-1 gene:ENSGGOG00000004764 transcript:ENSGGOT00000004793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWGGRGQSFNIAPQKEEPEMGSVQENRMPEPRSRQPSSCLASRCLPGEQILAWAPGVRK
GLEPELSGTLICTNFRVTFQPCGWQWNQDTPLNSEYDFALVNIGRLEAVSGLSRVQLLRP
GSLHKFIPEEILIHGRDFRLLRVGFEAGGLEPQAFQVTMAIVQARAQSNQAQQYSGITLS
KAGQGSGSRKPPIPLMETAEDWETERKKQAARGWRVSTVNERFDVATSLPRYFWVPNRIL
DSEVRRAYGHFHQGRGPRLSWHHPGGSDLLRCGGFYTASDPNKEDIRAVELMLQAGHSDV
VLVDTMDELPSLADVQLAHLRLRALCLPDSSVAEDKWLSALEGTRWLDYVRACLRKASDI
SVLVTSRVRSVILQERGDRDLNGLLSSLVQLLSAPEARTLFGFQSLVQREWVAAGHPFLT
RLGGTGASEEAPVFLLFLDCVWQLLQQFPADFEFSEFFLLALHDSVRVPDTLTFLRNTPW
ERGKQSGQLNSYTQVYTPGYSQPPAGNSFNLQLSVWDWDLRYSNAQILQFQNPGYDPEHC
PDSWLPRPQPSFMVPGPPSSVWLFSRGALTPLNQLCPWRDSPSLLAVSSRWLPRPAISSE
SLADQEWGLPSHWGACPLPPGLLLPGYLGPQIRLWRRCYLRGRPEVQMGLSAPTVSGLQD
ELSHLQELLRKWTPRISPEDHSKKRDPHTILNPTEIAGILKGRAEGDLG
Download sequence
Identical sequences ENSGGOP00000004673 ENSGGOP00000004673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]