SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004702 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004702
Domain Number 1 Region: 2020-2090
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.03e-18
Family TB module/8-cys domain 0.0000967
Further Details:      
 
Domain Number 2 Region: 927-995
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.31e-17
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 3 Region: 1004-1133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.55e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 2098-2212
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-17
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 1496-1569
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.94e-17
Family TB module/8-cys domain 0.0000603
Further Details:      
 
Domain Number 6 Region: 1169-1292
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.26e-16
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 7 Region: 1912-2027
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.3e-16
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 8 Region: 632-705
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-16
Family TB module/8-cys domain 0.00057
Further Details:      
 
Domain Number 9 Region: 1818-1943
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.14e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 10 Region: 691-827
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 11 Region: 426-556
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.61e-16
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 12 Region: 510-637
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.53e-16
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 13 Region: 2313-2383
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000144
Family TB module/8-cys domain 0.00058
Further Details:      
 
Domain Number 14 Region: 1656-1722
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000017
Family TB module/8-cys domain 0.00059
Further Details:      
 
Domain Number 15 Region: 299-369
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000209
Family TB module/8-cys domain 0.0021
Further Details:      
 
Domain Number 16 Region: 153-238
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000445
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 17 Region: 824-908
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000288
Family TB module/8-cys domain 0.002
Further Details:      
 
Domain Number 18 Region: 2467-2598
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000675
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 19 Region: 1379-1506
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000122
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 20 Region: 1288-1422
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000377
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 21 Region: 200-304
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000115
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 22 Region: 1575-1630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000209
Family EGF-type module 0.00077
Further Details:      
 
Domain Number 23 Region: 2421-2477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000257
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 24 Region: 2382-2435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000251
Family EGF-type module 0.01
Further Details:      
 
Domain Number 25 Region: 2582-2679
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000314
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 26 Region: 1734-1789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000536
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 27 Region: 1777-1815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000922
Family EGF-type module 0.014
Further Details:      
 
Domain Number 28 Region: 2223-2260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000187
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004702
Domain Number - Region: 125-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00922
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 93-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0894
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004702   Gene: ENSGGOG00000004780   Transcript: ENSGGOT00000004822
Sequence length 2836
Comment pep:novel chromosome:gorGor3.1:19:8292918:8377406:-1 gene:ENSGGOG00000004780 transcript:ENSGGOT00000004822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGQGRWDGALQAAGPGRVRRRGSPGILQGPNVCGSRFHAYCCPGWRTFPGRSQCVVPICR
HACGEGFCSQPNLCTCADGTLAPSCGVSRGSGCSVSCMNGGTCQGASCLCQKGYTGTVCG
QPICDRGCHNGGRCIGPNRCACVYGFMGPQCERDYRTGPCFGQVGPEGCQHQLMGLVCTK
ALCCATVGRAWGLPCELCPAQPHPCRRGFIPNIHTGACQDVDECQAVPGLCQGGSCVNMV
GSFHCRCPVGHRLSDSSAACEDVNECLSLSGLCSGGDCTNTVGSYVCTCSQGFASSLDGT
HCLNYRAGTCFSVLFGGRCAGDLAGHYTRRQCCCDRGRCWAAGPVPELCPPRGSNEFQQL
CAQRLPLLPGHPGLFPGLLGFRSNGMGPPLGVWALGGEFGPGVGVCHVGFRPGMPLPAPP
VGTATLNQTIDICQHFTNLCLNGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSSPCH
HGDCVNIPGTYHCQCYPGFQATPTRQACVDVDECIVSGGLCHLGRCVNTEGSFQCVCNAG
FELSPDGKNCVDHDECATSTMCVNGVCLNEDGSFSCLCKPGFLLAPGGHYCMDIDECQTP
GICVNGHCTNTEGSFRCQCLGGLVVGTDGHMCVDTHVRSTCYGAIEKGSCARPFPGTVTK
SECCCANPDHGFGEPCQLCPAKNSAEFQALCSSGLGITTDGRDINECALDPEVCANGVCE
NLRGSYRCVCNLGYEAGASGKDCTDVDECALNSLLCDNGWCQNSPGSYSCSCPPGFHFCQ
DTEICKDVDECLSSPCMNGVCQNLAGSYTCKCGPGSRLDPSGAICLDSTKGTCWLKIQES
RCEVNLQGASLRSECCATLGAAWGSPCERCEIDPACARGFARMTGVTCDDVNECESFPGV
CPNGRCVNTAGSFRCECPEGLMLDASGRLCMDVRLEPCFLRWDEDECGVTLPGKYRMDVC
CCSLGAAWGAECEACPDPESLEFASLCPRGLGFASRDFLSGRPFYKDVNECKVFPGLCTH
GTCRNTVGSFHCACAGGFALDAQERNCTDIDECRISPDLCGQGTCVNTPGSFECECFPGY
ESGFVLMKDCMDVDECARDPLLCRGGTCTNTDGSYKCQCPPGHELMAEGTACEEGLSVYL
AMNVSTKGKCVCMCVGAQPQPLSALHPADINECRVQNGGCDVHCINTEGSYRCSCGQGYS
LMPDGRACADVDECEENPRVCDQGHCTNMPGGHHCLCYDGFMATPDMRTCVDVDECDLNP
HICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNIPGSFSC
RCLPGWVGDGFECHDLDECVSQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFSCEDRDEC
AENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECEQGNLCAFGSCENLPGMF
RCICNGGYELDRGGGNCTDINECADPVNCINGVCINTPGSYLCSCPQDFELNPSGVGCVD
TRAGNCFLETHDRGDGGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLC
PGGEGFRPNRITVILEDIDECQELPGLCQGGDCINTFGSFQCECPPGYHLSEHTRICEDI
DECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSVCFRHYNGTCQNELA
FNVTRKMCCCSYNIGQAWNRPCEACPTPTSPDYQILCGNQAPGFLIDIHTGKPLDIDECG
EIPAICANGICINQIGSFRCECPTGFNYNSILLACEDVDECGSRESPCQQNADCINIPGS
YRCKCTRGYKLSPGGACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCM
DIDECDRQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRFGHCLNT
AGSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPLGFQVQSDH
CIDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRQSFCFTRFEAGKC
SVPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGNAAFQELCPFGHGAVPGLDDSREDVN
ECAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDTDECSVGHPCGQGTCTNVIG
GFECACADGFEPGLMMTCEDIDECSLNPLLCAFRCHNTEGSYLCTCPAGYTGLNVSGAVS
GSSEDVDECADGQQDCHARGMECKNLIGTFACVCPPGMRPLPGSGEGCTGMGHWSFRGAG
NPLWKGEVNGRDRQWGGQAVGGTGSGGDKKKNNIRQGPCFAEVLQTTCRSLSSSSEAVTR
AECCCGGGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRDVDECRMFAHLCAHGECIN
SLGSFRCHCQAGYTLDATATTCLDVDECSQVPKPCTFLCKNTKGSFLCSCPRGYLLEEDG
RTCKDLDECTSRQHNCQFLCVNTVGAFTCRCPPGFTQRHQACFDNDECSAQPGSCGARGH
CHNTPGSFRCECHQGFTLDSSGHGCEDVNECDGPHRCQHGCQNQLGGYRCGCPQGFTQHS
QWAQCVDENECALSPPTCGSASCHNTLGGFRCVCPSGFDFDQALGGCQDVDECAGRRGPC
SYSCANTPGGFLCGCPQGYFRAGQGHCVSGLGFSPGPQDTPDKEELLSSEACYECKINGL
SPRDRPRRSAHRDHQPSPKGSESVNLATLDSEALLTLGLNLSHLGQAERILELRPALEGL
EGRVRYVIVRGNEQGFFRMHCLRGVSSLQLGRRRPGPGTYRLEVVSHMAGPWGVQPEGQP
GPRGQALRLKVQLQLL
Download sequence
Identical sequences ENSGGOP00000027011 ENSGGOP00000004702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]