SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004803 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004803
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000596
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 2 Region: 68-126
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000458
Family B-box zinc-binding domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000004803
Domain Number - Region: 109-218
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0785
Family Hemolysin E (HlyE, ClyA, SheA) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004803   Gene: ENSGGOG00000004900   Transcript: ENSGGOT00000004926
Sequence length 258
Comment pep:novel chromosome:gorGor3.1:6:31112864:31124914:1 gene:ENSGGOG00000004900 transcript:ENSGGOT00000004926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPC
SEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNR
RSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGLESQHQTREQLGALPQQWLG
QLEHMPAEAARILDISRAVTQLSSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIY
PQLEKGVSELLLQPPQKL
Download sequence
Identical sequences A0A2J8NX38 G3QQD8
9598.ENSPTRP00000030564 ENSGGOP00000004803 ENSGGOP00000004803 XP_003829793.1.60992 XP_004043607.1.27298 XP_016810235.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]