SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004826 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004826
Domain Number 1 Region: 41-230
Classification Level Classification E-value
Superfamily L domain-like 1.76e-36
Family Ngr ectodomain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004826   Gene: ENSGGOG00000004926   Transcript: ENSGGOT00000004949
Sequence length 334
Comment pep:novel chromosome:gorGor3.1:9:120823288:120824558:-1 gene:ENSGGOG00000004926 transcript:ENSGGOT00000004949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLSWSRPRPLLLLLLLSPWPVWAQVSATASPSGSPGAPDCPEVCTCVPGGLASCSALS
LPAVPAGLSLRLRALLLDHNRVRALPPGAFAGAGALQRLDLSENGLHSVHVRAFWGLGAL
QLLDLSANQLEALAPGTFAPLRELRNLSLAGNRLARLEPAALGALPLLRSLSLQDNELAA
LAPGLLGRLPALDALHLRGNPWGCGCALRPLCAWLRRHPLPASEAETVLCVWPGRLTLSP
LTAFSDAAFSHCAQPLALRDLAVVYTLGPASFLVSLASCLALGSGLTACRARRRRRLRTA
ALRPPRPPDPNPDPDPHGCASPADPGSPAAAAQA
Download sequence
Identical sequences G3QQG0
ENSGGOP00000004826 ENSGGOP00000004826 XP_004048973.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]