SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004876 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004876
Domain Number 1 Region: 628-738
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 451-562
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-20
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 3 Region: 745-810
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000148
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 277-394
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000419
Family Spermadhesin, CUB domain 0.0054
Further Details:      
 
Domain Number 5 Region: 804-866
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000709
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 872-931
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000119
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 392-453
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000347
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 567-631
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000944
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004876   Gene: ENSGGOG00000004972   Transcript: ENSGGOT00000005001
Sequence length 1024
Comment pep:novel chromosome:gorGor3.1:22:10201263:10417873:1 gene:ENSGGOG00000004972 transcript:ENSGGOT00000005001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAARPPAAGLRGISLFLALLLGSPAAALERDALPEGDASPLGPYLLPSGALERGSPGKE
HPEERVVTAPPSSSQSAEVLGELELDGTAPSAHYDTPALSPLLPEEARPKHALPPKKKLP
SLKQVNSARKQLRPKATSAATVQRAGSQPASQGLDLLSSSTEKPGPPGDPDPIVASEEAS
EVPLWLDRKESAVPTTPAPLQISPFTSQPYVAHTLPQRPEPGEPGPDMAQEAPQEDTSPM
ALMDKGENELTGSASEESQETTTSTIITTTVITTEQAPALCSVSFSNPEGYIDSSDYPLL
PLNNFLECTYNVTVYTGYGVELQVKSVNLSDGELLSIRGVDGPTLTVLANQTLLVEGQVI
RSPTNTISVYFRTFQDDGLGTFQLHYQAFMLSCNFPRRPDSGDVTVMDLHSGGVAHFHCH
LGYELQGAKMLTCINASKPHWSSQEPICSAPCGGAVHNATIGRVLSPSYPENTNGSQFCV
WTIEAPEGQKLHLHFERLLLHDKDRMTVHSGQTNKSALLYDSLQTESVPFEGLLSEGNTI
RIEFTSDQARAASTFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTIVEFTCDPGHSL
EQGPAIIECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYVEGEDCIWKIHV
GEEKRIFLDIQFLNLSNSDILTIYDGDEVMPHILGQYLGNSGPQKLYSSTPDLTIQFHSD
PAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARITYQCDPGYDIV
GSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNPGFVL
EGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRLYLPGESLTFM
CYEGFELMGEVTIRCILGQPSHWNGPLPVCKVNQDSFEHALEVAEAAAETSLEGGNMALA
IFIPVLIISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETREY
EVSI
Download sequence
Identical sequences G3QQK8
XP_004063248.1.27298 ENSGGOP00000004876 ENSGGOP00000004876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]