SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004877 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004877
Domain Number 1 Region: 31-470
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.07e-100
Family Integrin alpha N-terminal domain 0.0000000000000452
Further Details:      
 
Domain Number 2 Region: 753-981
Classification Level Classification E-value
Superfamily Integrin domains 2.3e-68
Family Integrin domains 0.00000000138
Further Details:      
 
Domain Number 3 Region: 471-582
Classification Level Classification E-value
Superfamily Integrin domains 1.2e-25
Family Integrin domains 0.000001
Further Details:      
 
Domain Number 4 Region: 631-745
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-24
Family Integrin domains 0.00000074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004877   Gene: ENSGGOG00000004971   Transcript: ENSGGOT00000005002
Sequence length 1032
Comment pep:novel chromosome:gorGor3.1:2b:74754544:74843327:1 gene:ENSGGOG00000004971 transcript:ENSGGOT00000005002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPRRRLRLGPRGLPVLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDADFVSGVPRAARTLGMVYIYDGKNMSSLYNFTG
EQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTT
KLNGFEVFARFGSAIAPLGDLDQDGFNADIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPS
QILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLE
VYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAI
RRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRVRANFSATLLFLFKPLEEASDFRPA
KTSYRAQICIKCLKKCDSSKRAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLI
VKLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSE
MDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHIFLPIPNWEHKENP
ETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDM
EINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQV
GRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTL
VTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQL
QPHENGEGNSET
Download sequence
Identical sequences ENSGGOP00000004877 ENSGGOP00000004877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]