SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004920 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004920
Domain Number 1 Region: 1-151,187-334
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.85e-55
Family G proteins 0.0000118
Further Details:      
 
Domain Number 2 Region: 658-666,703-869,920-949
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.21e-34
Family Translational machinery components 0.0083
Further Details:      
 
Domain Number 3 Region: 952-1064
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.77e-29
Family EF-G/eEF-2 domains III and V 0.00055
Further Details:      
 
Domain Number 4 Region: 582-656
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.4e-18
Family EF-G/eEF-2 domains III and V 0.00026
Further Details:      
 
Domain Number 5 Region: 469-575
Classification Level Classification E-value
Superfamily Translation proteins 3e-17
Family Elongation factors 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004920   Gene: ENSGGOG00000005017   Transcript: ENSGGOT00000005047
Sequence length 1088
Comment pep:novel chromosome:gorGor3.1:15:61982857:62111474:-1 gene:ENSGGOG00000005017 transcript:ENSGGOT00000005047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKTTLADCLISSNGIISSRLAGKLRYMDSREDEQIRGITMKSSAISLHYAAVNSFYLIHL
PGSVVHLGFTQESAICSRVCAAKENLIIHFSFCFYQTQAVLRQAWLENIRPVLVINKIDR
LIVELKFTPQEAYSHLKNILEQINALTGTLFTSKVLEERAERETESQVNPNSEQGEQVYD
WSTGLEDTDDSHLYFSPEQGNVVFTSAIDGWGFGIEHFARIYSQKIGIKKEVLVKTLWGD
YYINMKAKRIMKGDQAKGKKPLFVQLILENIWSLYDAVLKKDKDKIDKIVTSLGLKIGAR
EARHSDPKVQINAICSQWLPISHAVLAMVCQKLPSPLDITAERVERLMCTGSQTFDSLPP
ETQALKADILLMRKEAPIVGFVGSMKFVSMYFLRENVPLPLTQEEIAQRHERARQRHAEK
LAAAQGQAPLEPTQDGSAIETCPKGDEPRGDEQQVESMTPKPVLQEENNQESFIAFARVF
SGVARRGKKIFVLGPKYSPLEFLRRVPLGFSASPDGLPQVPHMAYCALENLYLLMGRELE
YLEEVPPGNVLGIGGLQDFVLKSATLCSLPSCPPFIPLNFEATPIVRVAVEPKHPSEMPQ
LVKGMKLLNQADPCVQILIQETGEHVLVTAGEVHLQRCLDDLKERFAKIHISVSEPIIPF
RETITKPPKVDMVNEEIGKQQKVAVIHQMKEDQSKIPEGIQVDSDGLITITTPNKLATLS
VRAMPLPEEVTQILEENSDLIRSMEQLTSSLNEGENTHMIHQKTQEKIWEFKGKLEQHLT
GRRWRNIVDQIWSFGPRKCGPNILVNKSEDFQNSVWTGPADKASKEASRYRDLGNSIVSG
FQLATLSGPMCEEPLMGVCFVLEKWDLSKFEEQGASDLAKEGQEENETCSGGNENQELQD
GCSEAFEKRTSQKGESPLTDCYGPFSGQLIATMKEACRYALQVKPQRLMAAMYTCDIMAT
GDVLGRVYAVLSKREGRVLQEEMKEGTDMFIIKAVLPVAESFGFADEIRKRTSGLASPQL
VFSHWEIIPSDPFWVPTTEEEYLHFGEKADSENQARKYMNAVRKRKGLYVEEKIVEHAEK
QRTLSKNK
Download sequence
Identical sequences ENSGGOP00000004920 ENSGGOP00000028114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]