SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004959 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004959
Domain Number 1 Region: 46-177
Classification Level Classification E-value
Superfamily L domain-like 1.22e-24
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004959   Gene: ENSGGOG00000005060   Transcript: ENSGGOT00000005086
Sequence length 287
Comment pep:novel chromosome:gorGor3.1:7:16638806:16696456:1 gene:ENSGGOG00000005060 transcript:ENSGGOT00000005086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWDPNPVPRTLRCWRLRRASETALQSSRRAVEDQLKICGHKRDADVFELFLSKKELTEV
IDLSRFKKLKYLWLHHNKLHGITFLTRNYCLTELYLNNNAIFEIEGLHYLPSLHILLLHH
NELTNIDATVKELKGMLNLKILSLYQNPLCQYNLYRLYIIYHLPGVELLDRNQVTEKERR
SMITIFNHKKAHIVQSIAFGGKVDASRDPKSPFKQKPAQRVPSDFAFANNVDKTVFDDPE
DAVFVRSMKRSVMTLTSMNWDTVPTREERYLEEEGTEPAQMLTVTLR
Download sequence
Identical sequences G3QQT5
ENSGGOP00000004959 ENSGGOP00000004959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]