SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004978 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004978
Domain Number 1 Region: 221-504
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.13e-110
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000505
Further Details:      
 
Domain Number 2 Region: 508-794
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.7e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004978   Gene: ENSGGOG00000005074   Transcript: ENSGGOT00000005105
Sequence length 804
Comment pep:novel chromosome:gorGor3.1:20:2975466:3075726:1 gene:ENSGGOG00000005074 transcript:ENSGGOT00000005105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSAAEPVKEEAKTSNPTSSLTSLS
VAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEP
WEGNSSTTATTPETFPPSDETPIIAVMVALSSLLVIVFIIIVLYMLRRFRKAELMSRNTE
KYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDN
KLFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINA
SFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQG
CWTYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPI
GMLKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIR
AQRCQMVQTDMQYVFIYQALLEHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFK
KLTSIKIQNDKMRTGNLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYR
QKDSYIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDI
TVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQK
QQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTL
EQYEFCYKVVQEYIDAFSDYANFK
Download sequence
Identical sequences ENSGGOP00000004978 ENSGGOP00000004978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]