SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005012 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005012
Domain Number 1 Region: 166-357
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.24e-86
Family p53 DNA-binding domain-like 0.000000665
Further Details:      
 
Domain Number 2 Region: 545-610
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.86e-20
Family SAM (sterile alpha motif) domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 393-433
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000445
Family p53 tetramerization domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005012   Gene: ENSGGOG00000005113   Transcript: ENSGGOT00000005140
Sequence length 681
Comment pep:novel chromosome:gorGor3.1:3:191205134:191480272:1 gene:ENSGGOG00000005113 transcript:ENSGGOT00000005140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD
FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWWPQYTNLGLLNS
MDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDV
SFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTE
VVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEF
TTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSI
RKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKE
SLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLSKMNSMNKLPSVS
QLINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTP
PPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWK
GILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWN
DFNFDMDARRNKQQRIKEEGE
Download sequence
Identical sequences ENSGGOP00000020551 ENSGGOP00000005012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]