SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005100 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005100
Domain Number 1 Region: 826-934
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-24
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 306-431
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 26-160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.32e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 668-823
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000115
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 269-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000829
Family EGF-type module 0.016
Further Details:      
 
Domain Number 6 Region: 200-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000346
Family EGF-type module 0.024
Further Details:      
 
Domain Number 7 Region: 159-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000035
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005100   Gene: ENSGGOG00000005201   Transcript: ENSGGOT00000005231
Sequence length 1012
Comment pep:novel chromosome:gorGor3.1:22:27577609:27722099:-1 gene:ENSGGOG00000005201 transcript:ENSGGOT00000005231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCTIGHLPWGHTLPLVPPTPLPTGSVDVDECSEGTDDCHIDAICQNTPKSYKCLCKPGYK
GEGKQCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDGHNCLDVDECQDNNG
GCQQICVNAMGSYECQCHSGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKGGVA
CDCRPGFDLAQNQKDCTLTCNYGNGGCQHSCEDTDTGPMCGCHQKYALHSDGRTCIEKDE
AAIERCQFNATSVADVDKRVKRRLLMETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPD
GKTCKDINECLVNNGGCDHFCRNTVGSFECGCRKGYKLLTDERTCQDIDECSFERTCDHT
CINSPGSFQCLCHRGYILYGTTHCGDVDECSMSNGSCDQGCVNTKGSYECVCPPGRRLHW
NRKDCVETGKCLSRAKTSPRAQLSCSKAGGVESCFLSCPAHTLFVPDSENSYVLSCGVPG
PQGKALQKRNGTSSGLGPSCSGAPTTPIKQKARFKIRDAKCHLWPHSQTRAKETARQPLL
DHCHVTFVTLKCDSSKKRRRGRKSPSKEVSHITAEFEIETKMEETSDTCEADCLRKRAEQ
SLQAAIKTLRKSIGRQQFYVQVSGTEYEVAQRPAKALEGQGACGAGQVLQDSKCVACGPG
THFGGELGQCVPCMPGTYQDMEGQLSCTPCPSSDGLGLAGARNVSECGGQCSPGFFSADG
FKPCQACPVGTYQPEPGRTGCFPCGGGLLTKHEGTTSFQDCEAKVHCSPGHHYNTTTHRC
IRCPVGTYQPEFGQNHCITCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGYIESPNYPG
DYPANAECVWHIAPPPKRRILIVVPEIFLPIEDECGDVLVMRKSASPTSITTYETCQTYE
RPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQEI
LKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences ENSGGOP00000005100 ENSGGOP00000023731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]