SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005214 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005214
Domain Number 1 Region: 147-182
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000034
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005214
Domain Number - Region: 315-397
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005214   Gene: ENSGGOG00000005324   Transcript: ENSGGOT00000005350
Sequence length 495
Comment pep:novel chromosome:gorGor3.1:5:42528164:42532900:1 gene:ENSGGOG00000005324 transcript:ENSGGOT00000005350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCRQFSLSYLSHSGWGGGGGVGSGASIRSSSRFSSSGGGGGGGRFSSSSGSGGGSSRVC
GRRGGSSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGSGSGG
GFGGGYGGGFGGFGGGAGGGDGGILTANEKSTMQELNSRLASYLDKVQALEEANNDLENK
IQDWYDKKGPAAIQKNYSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTRMTLDDFRIKFE
MEQNLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLTGQNS
GDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEVQ
SSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKSYGGGSGSGGGSGGGHSGGSGG
GHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASG
SGGGYGGGSGKSSHS
Download sequence
Identical sequences ENSGGOP00000005214 ENSGGOP00000005214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]