SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005429 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005429
Domain Number 1 Region: 412-480
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000000366
Family Intermediate filament protein, coiled coil region 0.00091
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005429
Domain Number - Region: 57-87
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000628
Family Intermediate filament protein, coiled coil region 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005429   Gene: ENSGGOG00000005544   Transcript: ENSGGOT00000005572
Sequence length 517
Comment pep:novel chromosome:gorGor3.1:1:19493991:19533339:-1 gene:ENSGGOG00000005544 transcript:ENSGGOT00000005572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNSLLFGEMALAFGCPPGGGGGGCPGGGGGGGGAGPGPSPVTAALRDDLGSNIHLLKGL
NVRFRCFLAKVHELERRNRLLEKQLEQQQSERERRLRYKTFSREQAVQTGPELLRPPAPG
GGHGLSSGAAAGANANAVALGGLPPGGGSHPQHYGRLPGTIWSYTQVRRTGGGGVETVQG
PGVSWVHPDGVGVQIDTITPEIRALYNVLAKVKRERDEYKRRWEEELAKRMNLQTMVDTL
QEAAQEADAIQEEMNEKIERLKAELVVFKGLMSDPMTDLDTKIQEKAMKVDMDICRRIDI
TAKLCDVAQQRNSEDVSKIFQVVPKKKERKVASDDDISEQDGEVNRFSDDEVGSMNITDE
MKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCNPTIDLQGEQEENLGNLIHET
ESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCSMKRGLDVQMETCRRLIKGS
ADRNSPSPSSVASSDSGSTDEIQDEFEREADVEPMVS
Download sequence
Identical sequences A0A2I2YJY9 H2PY67 Q5TF58
9606.ENSP00000387941 gi|210147457|ref|NP_001129737.1| ENSGGOP00000005429 ENSP00000387941 ENSP00000387941 ENSP00000387941 NP_001129737.1.87134 NP_001129737.1.92137 XP_003307885.2.37143 XP_004024829.1.27298 ENSGGOP00000005429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]