SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005504 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005504
Domain Number 1 Region: 139-198
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000144
Family SNARE fusion complex 0.0000458
Further Details:      
 
Domain Number 2 Region: 12-98
Classification Level Classification E-value
Superfamily t-snare proteins 0.00000000000000432
Family t-snare proteins 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005504   Gene: ENSGGOG00000005620   Transcript: ENSGGOT00000005648
Sequence length 232
Comment pep:novel chromosome:gorGor3.1:14:48759672:48782396:-1 gene:ENSGGOG00000005620 transcript:ENSGGOT00000005648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEKKKKTILLFQKEEQEKPSQLA
EMEEELRYAPLSFRNPMMSKLRKYRKDLAKLHREVRSTPLTATPGGRGDMKYGIYAVENE
HMNRLQSQRAVLLQGTESLNRATQSIERSHRIATETDQIGSEIIEELGEQRDQLERTKSR
LVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLELAILGGLVYYKFFRSH
Download sequence
Identical sequences ENSGGOP00000005504 ENSGGOP00000024586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]