SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005566 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005566
Domain Number 1 Region: 34-185
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.27e-43
Family Cofilin-like 0.000000213
Further Details:      
 
Domain Number 2 Region: 200-359
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.78e-38
Family Cofilin-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005566   Gene: ENSGGOG00000005679   Transcript: ENSGGOT00000005711
Sequence length 384
Comment pep:novel chromosome:gorGor3.1:12:41580266:41592911:-1 gene:ENSGGOG00000005679 transcript:ENSGGOT00000005711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRRGWRRSSHFLEPPAGAAGCTQRRSRELAAAAMSHQTGIQASEDVKEIFARARNGKYR
LLKISIENEQLVIGSYSQPSDSWDKDYDSFVLPLLEDKQPCYILFRLDSQNAQGYEWIFI
AWSPDHSHVRQKMLYAATRATLKKEFGGGHIKDEVFGTVKEDVSLHGYKKYLLSQSSPAP
LTAAEEELRQIKINEVQTDVGVDTKHQTLQGVAFPISREAFQALEKLNNRQLNYVQLEID
IKNEIIILANTTNTELKDLPKRIPKDSARYHFFLYKHSHEGDYLESIVFIYSMPGYTCSI
RERMLYSSCKSPLLEIVERQLQMDVIRKIEIDNGDELTADFLYEEVHPKQHAHKQSFAKP
KGPAGKRGIRRLIRGPAETEATTD
Download sequence
Identical sequences G3QSD3
ENSGGOP00000005566 XP_004053037.1.27298 ENSGGOP00000005566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]