SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005706 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005706
Domain Number 1 Region: 44-311
Classification Level Classification E-value
Superfamily L domain-like 1.5e-57
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 241-478
Classification Level Classification E-value
Superfamily L domain-like 4.19e-42
Family Ngr ectodomain-like 0.0065
Further Details:      
 
Domain Number 3 Region: 542-841
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.5e-29
Family Rhodopsin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005706   Gene: ENSGGOG00000005825   Transcript: ENSGGOT00000005855
Sequence length 964
Comment pep:novel chromosome:gorGor3.1:1:182113971:182286334:1 gene:ENSGGOG00000005825 transcript:ENSGGOT00000005855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPGLRSLLXCAALCASRRAGGAPQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAVPGD
LDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILMLQN
NQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALN
NLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNY
NELQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSAFQY
LPKLHTLSLNGATDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELSHNQ
IEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRSIHPEAFSTLRS
LVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCCPYG
MCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDLDLDELQLEMEDSKPHPSV
QCSPTPGPFKPCEYLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPVKFVVGA
IAGANILTGISCGLLASVDALTFGQFSEYGARWEMGLGCRATGFLAVLGSEASVLLLTLA
AVQCSVSISCVRAYGKSPSPGSIRAGVLGCLALAGLAAALPLASVGEYGASPLCLPYAPP
EGQPAALGFAVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAMWDCAMVRHVAWLIFADG
LLYCPVAFLSFASMLGLFPVMPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRRLRP
RAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVTLIS
CQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLRAEGSTPAGGGSSGGGGFRPSGLAF
ASHV
Download sequence
Identical sequences ENSGGOP00000005706 ENSGGOP00000005706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]