SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005761 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005761
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily Prefoldin 4.71e-21
Family Prefoldin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005761   Gene: ENSGGOG00000005886   Transcript: ENSGGOT00000005913
Sequence length 498
Comment pep:novel chromosome:gorGor3.1:19:27078936:27126570:1 gene:ENSGGOG00000005886 transcript:ENSGGOT00000005913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVVTNCQERIQHWKKVDNDYNALRERLSTLPDKLSYNIMVPFGPFAFMPGKLVHTNEVTV
LLGDNWFAKCSAKQAVGLVEHRKEHVRKTIDDLKKVMKNFESRVEFTEDLQKMSDAAGDI
VDIREEIKCDFEFKAKHRIAHKPHSKPKTSDIFEADIANDVKSKDLLADKELWARLEELE
RQEELLGELDSKPDTVIANGEDTTSSEEEKEDHNTNVNVMHQVTDSHTPCHKDVASSEPF
SGQVNSQLNCSVNGSSSYHSDDDDDDDDDDDNNNIDDDDGDNDHEALGFGDNSIPTIYFS
HTVEPKRVRINTGKNTTLKFSEKKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDV
VNGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEE
EPQENQQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPHPAIAHPALPTIPERKEVLLEASE
ETGKRVSKFKAARLQQKN
Download sequence
Identical sequences ENSGGOP00000005761 ENSGGOP00000005761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]