SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005775 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005775
Domain Number 1 Region: 3-228
Classification Level Classification E-value
Superfamily Aquaporin-like 4.06e-67
Family Aquaporin-like 0.00000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005775   Gene: ENSGGOG00000005898   Transcript: ENSGGOT00000005927
Sequence length 265
Comment pep:novel chromosome:gorGor3.1:12:47916246:47920431:1 gene:ENSGGOG00000005898 transcript:ENSGGOT00000005927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFGLAIGTLAQAL
GPVSGGHINPAITLALLVGNQISLLRAFFYVAAQLVGAIAGAGILYGVAPLNARGNLAVN
ALNNNTTQGQAMVVELILTFQLALCIFASTDSRRTSPVGSPALSIGLSVTLGHLVGIYFT
GCSMNPARSFGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIK
GTYEPDEDWEEQREERKKTMELTTR
Download sequence
Identical sequences G3QSX6 H2Q5W2 P55064
ENSGGOP00000005775 NP_001642.1.87134 NP_001642.1.92137 ENSP00000293599 ENSP00000293599 9606.ENSP00000293599 ENSP00000293599 gi|4502183|ref|NP_001642.1| ENSGGOP00000005775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]