SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005824 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005824
Domain Number 1 Region: 380-546,842-957
Classification Level Classification E-value
Superfamily Ras GEF 2.88e-62
Family Ras GEF 0.0018
Further Details:      
 
Domain Number 2 Region: 527-614
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-20
Family PDZ domain 0.0034
Further Details:      
 
Domain Number 3 Region: 258-382
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.06e-18
Family cAMP-binding domain 0.0011
Further Details:      
 
Domain Number 4 Region: 17-118
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000236
Family cAMP-binding domain 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005824
Domain Number - Region: 752-831
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000161
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005824   Gene: ENSGGOG00000005941   Transcript: ENSGGOT00000005979
Sequence length 1298
Comment pep:novel chromosome:gorGor3.1:5:114790626:115000515:-1 gene:ENSGGOG00000005941 transcript:ENSGGOT00000005979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSPVDPGARQALRKKPPERTPEDLNTIYSYLHGMEILSNLREHQLRLMSARARYERYSG
NQVLFCSETIARCWYILLSGSVLVKGCMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVEN
AKDNEDSILQREIPARQSRRRFRKINYKGERQTITDDVEVNSYLSLPADLTKMHLTENPH
PHVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEI
DRTDPLQGRDLVRECLEKEPADKTDDDIEQLLEFMHQLPAFANMTMSVRRELCSVMIFEV
VEQAGAIILEDGQELDSWYVILNGTVEISHPDGKVENLFMGNSFGITPTLDKQYMHGIVR
TKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIKAT
PERLIMHLIEEHSIVDPTYIEDFLLTYRTFLESPLDVGIKLLEWFKIDSLRDKVTRIVLL
WVNNHFNDFEGDPAMTRFLEEFEKNLEDTKMNGHLRLLNIACAAKAKWRQVVLQKASRES
PLQFSLNGGSEKGFGIFVEGVEPGSKAADSGLKRGDQIMEVNGQNFENITFMKAVEILRN
NTHLALTVKTNIFVFKELLFRTEQEKSGVPHIPKIAEKKSNRHSIQHVPGDIEQTSQEKG
SKKVKANTVSGGRNKIRKILDKTRFSILPPKLFSDGGLSQSQDDSIVGTRHCRHSLAIMP
IPGTLSSSSPDLLQPTTSMLDFSNPSDIPDQVIRVFKVDQQSCYIIISKDTTAKEVVFHA
VHEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGRYYLKNNMETETLC
SDEDAQELVKESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLNSKTGNTHL
KRFEDIVNQETFWVASEILTEANQLKRMKIIKHFIKIALHCRECKNFNSMFAIIYTLIPS
AKSDNLSDSSHSEISSRSSIVSNCSVDSMSAALQDERCSSQALAVPESTGALEKTEHPSG
IGDHSQHGPGWTLLKPSLIKCLAVSSSVSNEEISHEHIIIEAADSGRGSWTSCSSSSHDN
FQSLPNPKSWDFLNSYRHTHLDDPIAEVEPTDSEPYSCSKSCSRTCGQCKGSLERKSWTS
SSSLSDTYEPNYGTVKRRVLESTPAESSEGLDPKDATDPVYKTVTSSTEKGLIVYCVTSP
KKDDRYREPPPTPPGYLGISLADLKEGPHPHLKPPDYSVAVQRSKMMHNSLSRLPPASLS
SNLVACVPSKIVTQPQRHNLQPFHPKLADVTDADSEAD
Download sequence
Identical sequences ENSGGOP00000005824 ENSGGOP00000005824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]