SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gorilla gorilla 69_3.1 > ENSGGOP00000005852

Domain assignment for ENSGGOP00000005852 from Gorilla gorilla 69_3.1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGGOP00000005852
Domain Number 1	Region: 28-109
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	4.89e-26
Family	I set domains	0.0000142
Further Details:

Domain Number 2	Region: 213-309
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	1.57e-24
Family	I set domains	0.00000603
Further Details:

Domain Number 3	Region: 109-203
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	4.55e-21
Family	C2 set domains	0.00000345
Further Details:

Domain Number 4	Region: 392-479
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.000000000372
Family	I set domains	0.00022
Further Details:

Domain Number 5	Region: 310-392
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.00000000838
Family	C2 set domains	0.0000113
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGGOP00000005852 Gene: ENSGGOG00000005980 Transcript: ENSGGOT00000006009
Sequence length	532
Comment	pep:novel chromosome:gorGor3.1:19:10457934:10633521:1 gene:ENSGGOG00000005980 transcript:ENSGGOT00000006009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPPKVILPRGGSVLVTCSTSCDQPTLLGI ETPLPKKELLLLGNNQKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP LPSWQPVGKDLTLRCQVEGGAPRANLIVVLLRGEEELKREPAVGEPAEVTTTVPVEKDHH GANFLCRTELDLRPQGLKLFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQWLTCAVILGTQSQE TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPPGPRTQFLLKA TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ AWGNPLPELKCLKDGTFPLPVGESVTVTRDLEGTYLCRARSTQGEVTREVTVNVLSPRYE FVIIAVVAAAVIMGTAGLSTYLYNRQRKIRKYRLQQAQKGTPMKPNTQATPP
Download sequence
Identical sequences	Q5NKV9 ENSGGOP00000005852 ENSGGOP00000005852 NP_001266532.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]