SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005896 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005896
Domain Number 1 Region: 823-1102
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-70
Family Protein kinases, catalytic subunit 0.00000774
Further Details:      
 
Domain Number 2 Region: 512-815
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-43
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 3 Region: 388-489,518-543
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000209
Family SH2 domain 0.0058
Further Details:      
 
Domain Number 4 Region: 311-373
Classification Level Classification E-value
Superfamily PH domain-like 0.000000418
Family Third domain of FERM 0.022
Further Details:      
 
Domain Number 5 Region: 77-202
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000492
Family Second domain of FERM 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005896   Gene: ENSGGOG00000006028   Transcript: ENSGGOT00000006054
Sequence length 1123
Comment pep:novel chromosome:gorGor3.1:19:10540939:10565457:-1 gene:ENSGGOG00000006028 transcript:ENSGGOT00000006054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREPAVYR
CGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSSEEEIHHFKNESL
GMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRRFLRD
FQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAPTDPG
PESAAGPPTHEVLVTGTGGIQWWPVEEEVSKAPGSSGSSGRNPQSSLSGKKAKAHKAAGQ
PADRPREPLWVYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLVDGYF
RLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHPYRLI
LTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRAGDDC
FSLRRCCLPQPGETSNLIIMRGAWASTRTLNLSQLSFHRVDQKEITQLSHLGQGTRTNVY
EGRLQVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETASLMNQ
VSHMHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLASALSY
LENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLAPECL
PGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPELATL
TSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKIRDLG
EGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKG
CCEDQGEKSLQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQHYIHRDL
AARNVLLDNDSLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDV
WSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPCEV
YHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
Download sequence
Identical sequences ENSGGOP00000005896 ENSGGOP00000005896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]