SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005999 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005999
Domain Number 1 Region: 7-250
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.68e-25
Family WD40-repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005999   Gene: ENSGGOG00000006132   Transcript: ENSGGOT00000006160
Sequence length 277
Comment pep:novel chromosome:gorGor3.1:5:484640:520442:1 gene:ENSGGOG00000006132 transcript:ENSGGOT00000006160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLLPCNPHGNGLLYAGFNQDHGCFACGMENGFRVYNTDPLKEKEKQVMIWDDLKKKTVI
EIEFSTEVKAVKLRRDLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPPVDIPAHEGV
LSCIALNLQGTRIATASEKGTLIRIFDTSSGHLIQELRRGSQAANIYCINFNQDASLICV
SSDHGTVHIFAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSGSPCICAFGTEPNA
VIAICADGSYYKFLFNPKGECIRDVYAQFLEMTDDKL
Download sequence
Identical sequences ENSGGOP00000005999 ENSGGOP00000005999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]