SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006065 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006065
Domain Number 1 Region: 92-276
Classification Level Classification E-value
Superfamily L domain-like 1.8e-26
Family Ngr ectodomain-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006065   Gene: ENSGGOG00000006202   Transcript: ENSGGOT00000006227
Sequence length 298
Comment pep:novel chromosome:gorGor3.1:9:74292662:74312895:-1 gene:ENSGGOG00000006202 transcript:ENSGGOT00000006227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLQSTLLLLLFVPLIKPAPPTQQDSRIIYAYGTDNFEESIFSQDYEDKYLDGKNIKEK
ETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE
SAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLL
KLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDHNALESVPLNLPESLRVIH
LQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLGKHPNSFICLKRLPIGSYF
Download sequence
Identical sequences G3QTN6
ENSGGOP00000006065 XP_004048314.1.27298 XP_004048315.1.27298 ENSGGOP00000006065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]